Commands
2,423 on public2,423 commands
Command
Default Value
server.events
(Generated) Enables automatic server-side game events such as helicopter patrols, airdrops and cargo ship visitsserver.explosive_testing_mode
Lower damage of explosives to 1 and allow them to be triggered multiple timesserver.farmchickenlocalavoidance
Whether to run local avoidance for chickens, disabling might get a slight performance improvement but chickens will clipserver.favoritesendpoint
Domain name to save when players favorite your server. The port can be omitted if using the default port or a SRV DNS record is created.server.filefolderoverride
(Generated) Override the root storage folder for server files; leave empty to use the default server/identity pathserver.filerequestbytesburst
Burst of requested file data bytes each client can be sent before further requests are deferred. Replicated so clients throttle their own requests to matchserver.filerequestbytespersecond
Bytes per second of requested file data (sign textures, photos, cassette audio, sculpts) sent to each client; requests beyond this are deferred, not dropped. Replicated so clients throttle their own requests to matchserver.filerequestdebug
Print file request rate limiting activity to the server console: incoming requests, bytes sent, and per-connection budget usage as it recovers over timeserver.filerequestqueuelength
Maximum deferred file requests per client; requests beyond this are dropped (a legitimate client's own request throttle never fills the queue)server.fillchickencoop
(Generated) Debug command: fills all chicken coops within 5 metres of the calling player to their maximum capacity Action
server.fogofwar
Should the in-game map be covered by a fog of warserver.fogofwarrevealsize
How much area around the player is revealed when using fog of war. Must be a multiple of 32server.foodspoiling
Whether to run the food spoiling systemserver.foodspoilingbudgetms
(Generated) Maximum milliseconds per frame the server spends advancing food spoil timers; lower values reduce frame time impact at the cost of less frequent spoil updatesserver.fps
(Generated) Prints the current server frame rate in frames per second Action
server.funwaterdamagethreshold
server.funwaterwetnessgain
server.gamemode
(Generated) Short name of the game mode to activate on this server (e.g. 'softcore', 'hardcore'); applies convar overrides defined by that game mode's prefabserver.hardcorefirearmammunitioncraftingmultiplier
Multiplies crafting cost of firearm ammunitionserver.headerimage
(Generated) URL of the banner/header image shown at the top of this server's page in the server browserserver.hideplayermapdirection
Should hte player see their direction on the mapserver.hideplayeronmap
Should the player see their position on the mapserver.homingmissiletargetshab
If true hot air balloons can be shot down with homing missilesserver.hopperanimationbudgetms
How long per frame to spend animating items moving into the hopper (will be instant if <= 0)server.hostname
(Generated) Server name displayed in the server browserserver.http_connection_limit
(Generated) Maximum number of simultaneous outbound HTTP connections the server may have open at once; used for map uploads, ban checks, and other web requestsserver.identity
(Generated) Unique identifier for this server instance; determines the subfolder used for saves, configs and map dataserver.idlekick
(Generated) Minutes of in-game inactivity before a player is automatically kicked; set to 0 to disable idle kickserver.idlekickadmins
(Generated) Minutes of inactivity before admin players are idle-kicked; 0 disables idle kick specifically for admins regardless of idlekickmodeserver.idlekickmode
(Generated) Controls who is subject to the idle kick: 0 = nobody, 1 = non-admin players only, 2 = all players including adminsserver.incapacitatedrecoverchance
Base chance of recovery after incapacitated wounded stateserver.industrialallowquickmove
Enables a faster way to move items around during conveyor transfers. Should be on unless there's a issueserver.industrialcrafterfrequency
How often industrial crafters attempt to craft items (value is an interval measured in seconds). Setting to 0 will disable all craftingserver.industrialframebudgetms
How long per frame to spend on industrial jobsserver.industrialtransferstricttimelimits
When enabled industrial transfers will abort if they start to take too long. Will lead to inconsistent splitting but should retain performanceserver.ip
(Generated) IP address the server binds to; leave empty to bind to all interfacesserver.ipqueriespermin
(Generated) Maximum number of Steam server browser queries allowed per minute from a single IP addressserver.itemdespawn
(Generated) Seconds before items dropped on the ground despawn; default is 300 seconds (5 minutes)server.itemdespawn_container_max_multiplier
(Generated) Upper cap on the loot container despawn multiplier; at default 24 the maximum lifetime is 24 x 5 min = 2 hoursserver.itemdespawn_container_scale
(Generated) Multiplier applied to the base item despawn time for items sitting inside loot containers; default 2x extends their lifetimeserver.itemdespawn_quick
(Generated) Fast-despawn time in seconds used for short-lived dropped items such as empty casings or small debris; default 30 secondsserver.level
(Generated) Map level to load on startup, e.g. 'Procedural Map', 'Barren', or a custom map nameserver.leveltransfer
(Generated) When true the server sends the map file to clients so they can load it without re-generating it locallyserver.levelurl
(Generated) URL to download a custom map file from; if set the server will fetch and load this map instead of generating oneserver.listplayerreportcounts
List the amount of reports players on the server have received Action
server.listtoolcupboards
Prints all the Tool Cupboards on the server Action
server.listvendingmachines
Prints all the vending machines on the server Action
server.log_invalid_packet_lengths New
Logs network packets rejected for being empty or not byte-alignedserver.logoimage
(Generated) URL of the logo image shown for this server in the server browserserver.long_distance_sounds
(Generated) When enabled, long-distance ambient sounds (e.g. distant gunfire) are networked to clients; disabling may reduce bandwidth on busy serversserver.lowprioritybuoyancyrange
If no players are in this range kayaks, boogie boards and inner tubes will switch to a cheaper buoyancy systemserver.mapenabled
Can players use the in-game mapserver.maxclientinfosize
(Generated) Maximum byte size of the client info blob sent during the connection handshake; clients sending a larger payload are rejectedserver.maxconnectionsperip
(Generated) Maximum number of simultaneous connections allowed from the same IP address; helps mitigate connection-flooding attacks (clamped 1โ1000)server.maxdecryptqueuebytes
(Generated) Maximum total byte size of packets waiting for decryption; excess packets are dropped when the limit is reachedserver.maxdecryptqueuelength
(Generated) Maximum number of encrypted packets that can wait in the decryption queue before being droppedserver.maxdecryptthreadwait
(Generated) Maximum milliseconds the decryption thread will block before timing out; increase if CPU-heavy encryption causes dropped packets (clamped 1โ1000)server.max_explosive_protection
server.maxfoodspoiltimediffforitemstack
Maximum difference (in seconds) that two items with spoil timers can have and still be stackableserver.maximummapmarkers
How many markers each player can place